DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:77 Identity:18/77 - (23%)
Similarity:34/77 - (44%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            :|.||....|...:.|.|.:....|..:.:.|:|...|..:|.|:::|....||........::|
Zfish    47 RLVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSD 111

  Fly    68 SHAINSYLVSKY 79
            .:.|..|:.:.:
Zfish   112 YNQIIDYIETNF 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 18/76 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GST_C_Delta_Epsilon 91..208 CDD:198287
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 18/76 (24%)
Thioredoxin_like 48..120 CDD:294274 18/71 (25%)
GST_C_GDAP1L1 201..311 CDD:198335
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.