Sequence 1: | NP_611325.2 | Gene: | GstE3 / 37108 | FlyBaseID: | FBgn0063497 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018511.1 | Gene: | gdap1 / 553702 | ZFINID: | ZDB-GENE-050522-424 | Length: | 362 | Species: | Danio rerio |
Alignment Length: | 231 | Identity: | 50/231 - (21%) |
---|---|---|---|
Similarity: | 77/231 - (33%) | Gaps: | 79/231 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLTLYGIDGSPPVRSVLLTLRALNL---DFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFY 64
Fly 65 LADSHAINSYL-----------------------------------VSKYGRNDSLYPK------ 88
Fly 89 ------------------DLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALE 135
Fly 136 GVYKSLNLFL--------ENGN---YLAGDNLTIAD 160 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE3 | NP_611325.2 | GstA | 4..195 | CDD:223698 | 49/230 (21%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 24/110 (22%) | ||
GST_C_Delta_Epsilon | 91..208 | CDD:198287 | 21/81 (26%) | ||
gdap1 | NP_001018511.1 | GstA | 40..307 | CDD:223698 | 49/230 (21%) |
GST_N_GDAP1 | 40..112 | CDD:239350 | 23/74 (31%) | ||
GST_C_family | 193..304 | CDD:295467 | 18/74 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589739 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |