DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GDAP1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens


Alignment Length:285 Identity:51/285 - (17%)
Similarity:82/285 - (28%) Gaps:112/285 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GSPPVRS-----------------------VLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPL 52
            ||||:|:                       |.|.:....|..:...|:|...||.:|.|:::|..
Human    10 GSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNST 74

  Fly    53 HTVPALDDNGFYLADSHAINSYLVSKY----------GRNDSLYPKDLKKRAIVDQ--------- 98
            ..||.|......:.::..|..||...:          .:....||:....|.::|.         
Human    75 GEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHG 139

  Fly    99 -----RLHYDSSVVTSTGRAITFPL---------FWENKTEIPQARI------------------ 131
                 .|..||.:.......|...:         ..|...::.:|.|                  
Human   140 CILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKY 204

  Fly   132 -----DALEGVYKSLNLFLENGN----------YLAGDNLTIADFHVIAGLTGFFVFLPVDATKY 181
                 |.||.|...:...|:..|          :|.|::.|:||.                    
Human   205 LKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADV-------------------- 249

  Fly   182 PELAAWIKRIKELPYYEE--ANGSR 204
             .||..:.|:|.|.:...  .||.|
Human   250 -SLAVTLHRLKFLGFARRNWGNGKR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 47/272 (17%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/88 (24%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/172 (16%)
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 15/71 (21%)
GST_C_GDAP1 179..289 CDD:198336 21/116 (18%)
Required for mitochondrial localization 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.