DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gstt3

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:207 Identity:70/207 - (33%)
Similarity:106/207 - (51%) Gaps:23/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            || |.||....|.|.|:|.:..:...:.|..:.:.|::.:|....|.::|||..||||.|..|.|
  Rat    58 MG-LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVL 121

  Fly    66 ADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTS-TGRA----ITFPLFWENKTE 125
            |:|.||..||..||...|..||:||:.||.||:.|.:..:.:.| ..||    :.||:|...  .
  Rat   122 AESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQ--P 184

  Fly   126 IPQARIDA----LEGVYKSL-NLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDA-----TK 180
            :|..|:.:    |:|..:.| :.||:|..:|.|.::::||...|..|     ..||.|     ..
  Rat   185 VPPERLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITEL-----MHPVSAGCKIFES 244

  Fly   181 YPELAAWIKRIK 192
            .|:||||.:|::
  Rat   245 RPKLAAWRQRVE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 68/204 (33%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 91..208 CDD:198287 34/117 (29%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 27/74 (36%)
GST_C_Theta 149..273 CDD:198292 34/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348137
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.