DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gsto2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:219 Identity:57/219 - (26%)
Similarity:85/219 - (38%) Gaps:54/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPE-FLKINPLHTVPALD-DNGFY 64
            |::.||.:...|..:...|.|.|..:..|...:||:.    ||: |||.||..|||.|: .:|..
Zfish    21 GQIRLYSMRFCPFAQRTRLVLTAKGVKHDIININLVS----KPDWFLKKNPFGTVPVLETSSGQV 81

  Fly    65 LADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW------ENK 123
            :.:|.....||...|... .|.|.|..:||.....|...|.|:         |.|:      :..
Zfish    82 IYESPITCEYLDEVYPEK-KLLPSDPFERAQQKMLLELYSKVI---------PYFYKISMGKKRG 136

  Fly   124 TEIPQARIDALEGVYKSLNLFLEN--GNYLAGDNLTIADF---------------HVIAGLTGFF 171
            .::..|..:..|.:.: ||..|.|  ..|..||::|:.|:               |.:|      
Zfish   137 EDVSTAEAEFTEKLLQ-LNEALANKKTKYFGGDSITMIDYLIWPWFERAEMMGVKHCLA------ 194

  Fly   172 VFLPVDATKYPELAAWIKRIKELP 195
                    |.|||..||:.:.|.|
Zfish   195 --------KTPELRKWIELMFEDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 55/215 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/74 (32%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/128 (22%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 24/75 (32%)
GstA 25..210 CDD:223698 55/213 (26%)
GST_C_Omega 107..229 CDD:198293 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.