DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstD6

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:217 Identity:76/217 - (35%)
Similarity:123/217 - (56%) Gaps:14/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            :.||.:.|||..|:|::|.:|:.::|:...||....|.|:|.|:||||.||:|.|.||.|.:.::
  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65

  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIP--QARI 131
            .||..|||.:||::|||||||.:|:|:::|||::|...:........|||.   :|..|  |..:
  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLL---RTGKPGTQENL 127

  Fly   132 DALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-P 195
            :.|...:..||.||:..:|:||:.|::||. ||.........:..|..|:|.:..|.|..::: |
  Fly   128 EKLNAAFDLLNNFLDGQDYVAGNQLSVADI-VILATVSTTEMVDFDLKKFPNVDRWYKNAQKVTP 191

  Fly   196 YYEEANGSRAAQIIEFIKSKKF 217
            .::|       .:.....:|||
  Fly   192 GWDE-------NLARIQSAKKF 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 71/193 (37%)
GST_N_Delta_Epsilon 4..77 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/119 (27%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 31/72 (43%)
PLN02395 11..208 CDD:166036 71/207 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460317
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.