DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstD2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:199 Identity:77/199 - (38%)
Similarity:121/199 - (60%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            :..|.:.|....|:|::..:||.|:.:.|::|.||.|.|||||:|:||.||:|.|.||||.:.:|
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARID- 132
            .||..|||.|||::|.|.|.|.||||:::|||::|...:..:.....:|||   :|..|.:..| 
  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLF---RTGKPGSDEDL 127

  Fly   133 -ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-P 195
             .:|..:..|:.|||...|:|||.||:||..:::.::.|.| ...|.:||..::.|....|:: |
  Fly   128 KRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTP 191

  Fly   196 YYEE 199
            .::|
  Fly   192 GWDE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 75/193 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 91..208 CDD:198287 36/112 (32%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460252
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.