DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:156 Identity:45/156 - (28%)
Similarity:74/156 - (47%) Gaps:19/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EFLKINPLHTVPALDD-NGFYLADSHAINSYLVSKYGRNDSLY-PKDLKKRAIVDQRLHYDSSVV 107
            ||||..|...|||.:. .|.||::|:|| :||::    |:.|. .|....:|.|.|.:.:..:.:
  Fly    45 EFLKKFPGGKVPAFETAEGQYLSESNAI-AYLLA----NEQLRGGKCPFVQAQVQQWISFADNEI 104

  Fly   108 TSTGRAITFPLF-----WENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGL 167
            .....|..|||.     .:|.|...:|     |.|.:.||..|::..:|||:.:|:||..|.:.|
  Fly   105 VPASCAWVFPLLGILPQQKNSTAKQEA-----EAVLQQLNQKLQDATFLAGERITLADIVVFSSL 164

  Fly   168 TGFFVFL--PVDATKYPELAAWIKRI 191
            ...:.::  |...:.:..:..|...|
  Fly   165 LHLYEYVLEPSVRSAFGNVNRWFVTI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 45/156 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/32 (50%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/108 (24%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 16/38 (42%)
GstA 5..187 CDD:223698 43/151 (28%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 26/106 (25%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459949
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.