DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gsto1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:240 Identity:63/240 - (26%)
Similarity:93/240 - (38%) Gaps:63/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPE-FLKINPLHTVPALD-DNGFYLA 66
            :.||.:...|..:...|.|.|..:.:|...:||..    ||: ||:.|||..||.|: .:|..:.
Zfish    23 IRLYSMRFCPFAQRTRLVLNAKGIKYDTININLKN----KPDWFLEKNPLGLVPVLETQSGQVIY 83

  Fly    67 DSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYD-SSVVTSTGRAITFPLFWENKTEIPQAR 130
            :|.....||...|... .|.|.|..:||  .||:..: .|.||        |.|:    :||..|
Zfish    84 ESPITCEYLDEVYPEK-KLLPFDPFERA--QQRMLLELFSKVT--------PYFY----KIPVNR 133

  Fly   131 -----IDALEGVYK-SLNLFLE-----NGNYLAGDNLTIADF---------------HVIAGLTG 169
                 :.|||...| .|:.|.|     ...:..||::|:.|:               |.:.|.  
Zfish   134 TKGEDVSALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGT-- 196

  Fly   170 FFVFLPVDATKYPELAAWIKRIKELPYYEEANGSRAAQIIEFIKS 214
                        |||..|.:|:.|.|..:....|....:: |.||
Zfish   197 ------------PELKKWTERMMEDPTVKATMFSTETYMV-FYKS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 58/219 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/143 (23%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 22/73 (30%)
GstA 25..210 CDD:223698 58/217 (27%)
GST_C_Omega 107..229 CDD:198293 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.