DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstD9

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:198 Identity:78/198 - (39%)
Similarity:117/198 - (59%) Gaps:3/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |..|.:..|.|.||:|:|.|||.|:.:.|.|:|...|||||||:||||.||:|.|.|:||.:.:|
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66

  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFP-LFWENKTEIPQARID 132
            .||..||..||.::.||||||.::||:::|||.:|.|.:..:.....:| ||.:.|.......:.
  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131

  Fly   133 ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKE-LPY 196
            .::..:...|..|:...|.|.:.||:|||.::|.::.|.: ...|..||||:..|....|: :|.
  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEI-SEYDFGKYPEVVRWYDNAKKVIPG 195

  Fly   197 YEE 199
            :||
  Fly   196 WEE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 75/192 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 38/72 (53%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/111 (29%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 38/72 (53%)
GstA 4..187 CDD:223698 73/183 (40%)
GST_C_Delta_Epsilon 89..207 CDD:198287 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460291
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.