DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstZ1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:200 Identity:46/200 - (23%)
Similarity:89/200 - (44%) Gaps:27/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLTLRALNLDFDYKIVNLMEK---EHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLVSKY 79
            |.:.|....:|:|.|..:|::.   .....|:.::||:..||:|..:|..|.||.||..|| .:.
  Fly    48 VRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYL-EET 111

  Fly    80 GRNDSLYPKDLKKRAIVDQRLH---------YDSSVVTSTGR--AITFPLFWENKTEIPQARIDA 133
            ....:|.|:|..|||.:.:.:.         .:.||:...|:  ::.:...|.::         .
  Fly   112 RPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIGKDQSLQWAQHWISR---------G 167

  Fly   134 LEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKELPYYE 198
            .:|:.|.|:  ...|.:..||.|::||..::..:.....: ..|.|.||.:....:.::||..::
  Fly   168 FQGLEKVLS--HSAGKFCVGDELSMADICLVPQVRNARRY-KADLTPYPTIVRLNQELQELDVFK 229

  Fly   199 EANGS 203
            ..:.|
  Fly   230 ATHPS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 44/190 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/61 (33%)
GST_C_Delta_Epsilon 91..208 CDD:198287 22/123 (18%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 20/61 (33%)
maiA 35..240 CDD:273527 45/199 (23%)
GST_C_Zeta 122..236 CDD:198300 22/124 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.