DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gstt1b

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:194 Identity:63/194 - (32%)
Similarity:98/194 - (50%) Gaps:18/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76
            |.|.|||.:..:..|:.||||.::|.|......||.|||||...|.:.|..|.||:|.||..||.
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTG-RAITFPLFWEN--KTEIPQARID-ALEGV 137
            .|:...|..:|.||:|||.|::.|.:..:.:...| :.|.|.:....  ..|:|:.::: |.|.:
Zfish    76 DKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKEKMENAEENL 140

  Fly   138 YKSLNL----FLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPELAAWIKRIK 192
            ..:|.|    ||::..::.||.:::||...|..:     .|..||     ...|:|.||..|::
Zfish   141 NVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVF-----ENRPKLKAWKDRVR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 63/194 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/64 (45%)
GST_C_Delta_Epsilon 91..208 CDD:198287 29/115 (25%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 63/192 (33%)
GST_N_Theta 3..78 CDD:239348 29/66 (44%)
GST_C_Theta 91..217 CDD:198292 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.