DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and se

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:248 Identity:59/248 - (23%)
Similarity:95/248 - (38%) Gaps:72/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEF-LKINPLHTVPAL----DDN 61
            |.|.||.:...|..:.|.|.|.|..:.:....:||.:    |||: |:.||...||||    :..
  Fly    20 GILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTD----KPEWLLEKNPQGKVPALEIVREPG 80

  Fly    62 GFYLADSHAINSYLVSKYGRNDSLYPKD-LKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTE 125
            ...|.:|..|..||..:|... .|||:| |||   |..:|      :....||:....|..:   
  Fly    81 PPVLTESLLICEYLDEQYPLR-PLYPRDPLKK---VQDKL------LIERFRAVLGAFFKAS--- 132

  Fly   126 IPQARIDA--LEGVYKSLNLF-----LENGNYLAGDNLTIADFHVIAGLTGFFVFLP-------- 175
                  |.  ||..:..|:::     .....:..|:...|.|          ::..|        
  Fly   133 ------DGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILD----------YMIWPWCERLELL 181

  Fly   176 ---------VDATKYPELAAWIKRIKELP----YYEEANGSRAAQIIEFIKSK 215
                     .|.:::|:|..|::|:|..|    :|.||...     .||::::
  Fly   182 KLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQ-----AEFLRTR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 52/220 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/77 (32%)
GST_C_Delta_Epsilon 91..208 CDD:198287 25/144 (17%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 25/78 (32%)
GstA 22..215 CDD:223698 53/225 (24%)
GST_C_Omega 109..229 CDD:198293 28/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.