DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstE12

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:216 Identity:94/216 - (43%)
Similarity:136/216 - (62%) Gaps:1/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            |.|..||....|||.|:||||.:|:.||.:.:.:||::.|||.|||||:||.||:|.|.|....:
  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65

  Fly    66 ADSHAINSYLVSKYGRND-SLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQA 129
            .|||||.:|||.|||:.: .||||:|.:||.||.|||.||..:.:..|.:..|:.:...|:....
  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSID 130

  Fly   130 RIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL 194
            :|..::..::.|..||::..||.|.:||||||..:|.:|......|:|..|:|::.||:||:.||
  Fly   131 KIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAEL 195

  Fly   195 PYYEEANGSRAAQIIEFIKSK 215
            |||:|.||..|.::....|:|
  Fly   196 PYYQEVNGDGADELKSIFKAK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 82/191 (43%)
GST_N_Delta_Epsilon 4..77 CDD:239343 37/72 (51%)
GST_C_Delta_Epsilon 91..208 CDD:198287 44/116 (38%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 37/72 (51%)
GstA 6..201 CDD:223698 86/194 (44%)
GST_C_Delta_Epsilon 92..210 CDD:198287 44/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468011
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.