DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gr59f

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:224 Identity:40/224 - (17%)
Similarity:73/224 - (32%) Gaps:85/224 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLVSKYGRN 82
            ||:|.:.::||   :.:|.:|                      :..|:.  |..:..|::...||
  Fly    87 VLVTTQRVSLD---RYLNAIE----------------------SAIYVV--HIFSIMLLTWQCRN 124

  Fly    83 ------DSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSL 141
                  .::...||.:...:|         ...|.|.|...||              |.|::..|
  Fly   125 WAPKLMTNIVTSDLNRAYTID---------CNRTKRFIRLQLF--------------LVGIFACL 166

  Fly   142 NLF--------------LENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIK 192
            .:|              |...:|:..:.::...|      ..:::.|...|.:...|...::|  
  Fly   167 AIFFNIWTHKFVVYRSILSINSYVMPNIISSISF------AQYYLLLQGIAWRQRRLTEGLER-- 223

  Fly   193 EL-----PYYEEANGSRA--AQIIEFIKS 214
            ||     |...|....|.  |.:|:|.|:
  Fly   224 ELTHLHSPRISEVQKIRMHHANLIDFTKA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 33/201 (16%)
GST_N_Delta_Epsilon 4..77 CDD:239343 10/58 (17%)
GST_C_Delta_Epsilon 91..208 CDD:198287 23/137 (17%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 40/224 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.