DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstE4

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:221 Identity:112/221 - (50%)
Similarity:159/221 - (71%) Gaps:1/221 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            |||::|||:|.|||.|:.||||:||:|.|::..|||.|||:...:|.|.||.||||.|.|:...:
  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACI 65

  Fly    66 ADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVV-TSTGRAITFPLFWENKTEIPQA 129
            .|||||.:|||.||..:|.||||||.:||.|||.:|::|.|: .|..|.:|.|:.:..:..:|:.
  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRN 130

  Fly   130 RIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL 194
            ::|.:..||..:..||::.:::|||.||||||.:::.:|...|||.:|..|||::|||::|:|||
  Fly   131 QVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL 195

  Fly   195 PYYEEANGSRAAQIIEFIKSKKFTIV 220
            ||||||||..|||.:|.::||.||||
  Fly   196 PYYEEANGKGAAQFVELLRSKNFTIV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 90/191 (47%)
GST_N_Delta_Epsilon 4..77 CDD:239343 39/72 (54%)
GST_C_Delta_Epsilon 91..208 CDD:198287 52/117 (44%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 39/72 (54%)
GstA 6..196 CDD:223698 90/189 (48%)
GST_C_Delta_Epsilon 91..209 CDD:198287 52/117 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467988
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1211.800

Return to query results.
Submit another query.