DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstT1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:218 Identity:64/218 - (29%)
Similarity:110/218 - (50%) Gaps:22/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDG-SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFY 64
            |.|...|..|. |.|.|::.:.::.....|:...|.|.::|.|..|:..||....|||:.|..|.
  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65

  Fly    65 LADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRL---HYDSSVVTSTGRAITFPLFW--ENKT 124
            |.:|.:|..||..|...::.||||.|::||.||:.|   |::..:|.|    :.|...|  ..|.
  Fly    66 LGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCS----LFFRQVWLLPAKG 126

  Fly   125 EIPQARIDALEGVYKSL--------NLFLENGNYLAGDNLTIADFHVIAGLTGF-FVFLPVDATK 180
            ..|..:.::::.:.|.:        .|:||. ::|.||.||:||....:.:... .....|:..:
  Fly   127 LAPAPKPESVKKLIKDVESNLGLLERLWLEK-DFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQ 190

  Fly   181 YPELAAWIKRIKEL--PYYEEAN 201
            :|::|.|::|:::.  |||:||:
  Fly   191 FPKVAKWMERVRDATNPYYDEAH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 57/207 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/127 (26%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 57/203 (28%)
GST_N_Theta 5..80 CDD:239348 23/74 (31%)
GST_C_Theta 93..218 CDD:198292 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.