DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and mars1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_956370.1 Gene:mars1 / 338183 ZFINID:ZDB-GENE-030219-83 Length:922 Species:Danio rerio


Alignment Length:234 Identity:46/234 - (19%)
Similarity:87/234 - (37%) Gaps:60/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALD----DNGFYLADSHA 70
            :|:|....||..|....:..:.::|...|         |:.|..|.|.|.    .:|.:|...::
Zfish     7 EGNPHCLKVLAALELSGVRCETQLVKHEE---------KVVPYLTHPVLPILQLPSGQHLFSPNS 62

  Fly    71 INSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALE 135
            |..||....|:         |.....:|.|.:::   |:...|:           :...::.||:
Zfish    63 ICQYLFDVSGQ---------KATDATNQWLEWEA---TNLQPAV-----------LQSLQLVALQ 104

  Fly   136 G-------VYKSLNLFLENG------NYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAA- 186
            |       |.|....:||..      ::|..:.:::||..:.|.|   :..|...|.:..:|.| 
Zfish   105 GKRVEAAAVMKEPLSWLEQSLSKRKTSFLTDEVVSVADVVLWAAL---YPLLSDSAFEPGDLQAV 166

  Fly   187 --WIKRIKELPYYEEA-----NGSRAAQIIEFIKSKKFT 218
              |.:|:..:...:.|     .|..|..:..|::.:..|
Zfish   167 RGWFERVCSVSACQSAALRVLQGKGAEALKSFLQKQPVT 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 41/204 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/70 (24%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/137 (19%)
mars1NP_956370.1 GstA 1..173 CDD:223698 40/200 (20%)
GST_N_family 1..67 CDD:238319 15/68 (22%)
GST_C_MetRS_N 75..176 CDD:198340 22/117 (19%)
PRK12268 261..820 CDD:237029
MetRS_core 263..631 CDD:173907
Anticodon_Ia_Met 640..769 CDD:153411
MetRS_RNA 866..910 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.