DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstT3

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:228 Identity:68/228 - (29%)
Similarity:105/228 - (46%) Gaps:51/228 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLK-INPLHTVPALDDNGFYLADSHAINSYL 75
            |.|.|::.:..|..|:.|:..:|.|...|||..:|.| ||....||.:.|||:.||:|.||..||
  Fly    53 SQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYL 117

  Fly    76 VSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW-----------ENKTEI--- 126
            .:|....:.||||....::.||:.|.:....:..| .|:.|...|           |.|.|.   
  Fly   118 SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLT-CAMYFRTVWLEPLLTGRTPSEAKIETFRM 181

  Fly   127 -PQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDAT---------KY 181
             .:..:|.:|.|:      ||..::|.|.:||:||         .|....::.|         ||
  Fly   182 QMERNLDVVEEVW------LEGKDFLTGSSLTVAD---------IFAACEIEQTRMADYDVRIKY 231

  Fly   182 PELAAWIKRIKEL--PYYEEANGSRAAQIIEFI 212
            |::.||:||:::.  |||:.|:        ||:
  Fly   232 PKIRAWLKRVRQSCNPYYDVAH--------EFV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 62/209 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/65 (42%)
GST_C_Delta_Epsilon 91..208 CDD:198287 34/142 (24%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 27/67 (40%)
GstA 47..243 CDD:223698 62/205 (30%)
GST_C_Theta 135..259 CDD:198292 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.