DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:62/153 - (40%) Gaps:25/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLTLRALNLDFDYKIVNLMEKEHLKPEF-LKINPLHTVPALDDNGFYLADSHAINSYLVSKYGR 81
            :|..|:.::|.     |..::.:...|:| ......|. |.|.|||..:.::..|..:::.....
  Fly    52 LLAELKTISLK-----VTTVDMQKPPPDFRTNFEATHP-PILIDNGLAILENEKIERHIMKNIPG 110

  Fly    82 NDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLN--LF 144
            ..:|:.:| |:.|.:.:.|:            :...|....|.|   |:.:||....:.:|  |.
  Fly   111 GYNLFVQD-KEVATLIENLY------------VKLKLMLVKKDE---AKNNALLSHLRKINDHLS 159

  Fly   145 LENGNYLAGDNLTIADFHVIAGL 167
            ..|..:|.||.:...|..::..|
  Fly   160 ARNTRFLTGDTMCCFDCELMPRL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 32/153 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 13/59 (22%)
GST_C_Delta_Epsilon 91..208 CDD:198287 17/79 (22%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 13/65 (20%)
O-ClC 21..231 CDD:129941 32/153 (21%)
GST_C_CLIC 118..232 CDD:198307 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.