DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gdap1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:300 Identity:54/300 - (18%)
Similarity:84/300 - (28%) Gaps:114/300 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            :|.||....|...:.|.|.:....|..:...|:|...||.:|.|:::|....||.|......:.:
  Rat    25 RLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICE 89

  Fly    68 SHAINSYLVSKY----------GRNDSLYPKDLKKRAIVDQ--------------RLHYDSSVVT 108
            :..|..||...:          ......||:....|.::|.              .|..||.:..
  Rat    90 ATQIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPA 154

  Fly   109 STGRAITFPL---------FWENKTEIPQARI-----------------------DALEGVYKSL 141
            .....|...:         ..|...::.:|.|                       |.||.|...:
  Rat   155 YATTRIRGQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQV 219

  Fly   142 NLFLENGN----------YLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-- 194
            ...|:..|          :|.|::.|:||.                     .||..:.|:|.|  
  Rat   220 ETELQRRNEETPDEGNQPWLCGESFTLADV---------------------SLAVTLHRLKFLGF 263

  Fly   195 --------------PYYEEANGSRAAQIIEFIKSKKFTIV 220
                          .|||..           :|.|.|..|
  Rat   264 ARRNWGHGKRPNLESYYERV-----------LKRKTFNKV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 47/272 (17%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/188 (15%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 53/297 (18%)
GST_N_GDAP1 26..98 CDD:239350 19/71 (27%)
GST_C_GDAP1 179..289 CDD:198336 23/141 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.