DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gsto2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:207 Identity:49/207 - (23%)
Similarity:89/207 - (42%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPE-FLKINPLHTVPALDDNGFYL 65
            |.:.:|.:...|......|.|:|.::  .::|:|:..|.  ||: :...:|...||.|:::...|
  Rat    22 GVIRIYSMRFCPYSHRTRLVLKAKSI--RHEIININLKN--KPDWYYTKHPFGQVPVLENSQCQL 82

  Fly    66 A-DSHAINSYLVSKY-GRNDSLYPKDLKKRA----IVD-----QRLHYDSSVVTSTGRAITFPLF 119
            . :|.....||...: ||  .|:|.|..:||    :::     .:|..:..|....||..|    
  Rat    83 IYESVIACEYLDDVFPGR--KLFPYDPYERARQKMLLELFCKVPQLSKECLVALRCGRDCT---- 141

  Fly   120 WENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKY-PE 183
             :.|..:.| .:..||.:     |..:|..:..||::::.|:.|........|:...|...: |.
  Rat   142 -DLKVALRQ-ELCNLEEI-----LEYQNTTFFGGDSISMIDYLVWPWFERLDVYGLADCVNHTPM 199

  Fly   184 LAAWIKRIKELP 195
            |..||..:|:.|
  Rat   200 LRLWISSMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 47/203 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/74 (24%)
GST_C_Delta_Epsilon 91..208 CDD:198287 25/115 (22%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 18/75 (24%)