DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic6

DIOPT Version :10

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:150 Identity:30/150 - (20%)
Similarity:66/150 - (44%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLVSKYGRNDSLYPKDLKKRAIV 96
            ||...:|::.:.|.:.|:...|            .:|::..:.:.:|:    |.:.|:.||    
  Rat   451 KIEEFLEEKLVPPRYPKLGTQH------------PESNSAGNDVFAKF----SAFIKNTKK---- 495

  Fly    97 DQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADF 161
            |....|:.:::.:..:..::     ..:.:|. .|||    |.:.::.:....:|.||.||:||.
  Rat   496 DANDIYEKNLLRALKKLDSY-----LNSPLPD-EIDA----YSTEDVTVSQRKFLDGDELTLADC 550

  Fly   162 HVIAGLTGFFVFLPVDATKY 181
            :::..|.    .:.:.|.||
  Rat   551 NLLPKLH----IIKIVAKKY 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..200 CDD:440390 29/149 (19%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 29/149 (19%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 396..399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.