Sequence 1: | NP_611325.2 | Gene: | GstE3 / 37108 | FlyBaseID: | FBgn0063497 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006241513.1 | Gene: | Mars1 / 299851 | RGDID: | 1305321 | Length: | 910 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 49/199 - (24%) |
---|---|---|---|
Similarity: | 83/199 - (41%) | Gaps: | 34/199 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALD-DNGFYLAD 67
Fly 68 SHAINSY--LVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENK--TEI-- 126
Fly 127 PQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPE----LAAW 187
Fly 188 IKRI 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE3 | NP_611325.2 | GstA | 4..195 | CDD:223698 | 49/199 (25%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 23/75 (31%) | ||
GST_C_Delta_Epsilon | 91..208 | CDD:198287 | 25/109 (23%) | ||
Mars1 | XP_006241513.1 | Thioredoxin_like | 1..68 | CDD:294274 | 21/70 (30%) |
GstA | <47..189 | CDD:223698 | 37/149 (25%) | ||
GST_C_MetRS_N | 77..179 | CDD:198340 | 26/119 (22%) | ||
PRK12268 | 266..821 | CDD:237029 | |||
MetRS_core | 267..635 | CDD:173907 | |||
Anticodon_Ia_Met | 644..773 | CDD:153411 | |||
MetRS_RNA | 855..899 | CDD:238475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |