DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic4

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:164 Identity:38/164 - (23%)
Similarity:66/164 - (40%) Gaps:53/164 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHA-INSYLV-SKYGRNDSLYPKDLKKRA 94
            ||...:|:....|::||::|.|  |..:..|.   |..| .::|:. |:...|::|....||...
Mouse    90 KIEEFLEEVLCPPKYLKLSPKH--PESNTAGM---DIFAKFSAYIKNSRPEANEALERGLLKTLQ 149

  Fly    95 IVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIA 159
            .:|:.|:              .||    ..||.:   :::|.:..|...||:      ||.:|:|
Mouse   150 KLDEYLN--------------SPL----PDEIDE---NSMEDIKFSTRRFLD------GDEMTLA 187

  Fly   160 D-------------------FHVIAGLTGFFVFL 174
            |                   |.:..|:||.:.:|
Mouse   188 DCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 38/164 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 13/46 (28%)
GST_C_Delta_Epsilon 91..208 CDD:198287 21/103 (20%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 3/10 (30%)
O-ClC 17..252 CDD:129941 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.