DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic3

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:216 Identity:44/216 - (20%)
Similarity:76/216 - (35%) Gaps:65/216 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDGSPPVRSVLLTLRALNL---------------DFDYKIVNLMEKEHLK-----PEFLKINPLH 53
            :.|.|...:.:.|.|||::               |.|.|...|..:|.|:     |:|..:.|.:
  Rat    35 LKGVPFTLTTVDTRRALDVLKDFAPGSQLPILLYDGDVKTDTLQIEEFLEETLGPPDFPGLAPRY 99

  Fly    54 TVPALDDNGFYLADSHAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFP 117
            .......|..:    |..::::.:.. .::|:||.:.|:              .:|...|.:..|
  Rat   100 RESNTAGNDIF----HKFSAFIKNPVPTQDDALYQQLLR--------------ALTRLDRYLGTP 146

  Fly   118 LFWENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIAD------FHVIAGLTGFFVFLPV 176
            |..|...| |              :|......:|.||.||:||      .|::..:...|...|:
  Rat   147 LDHELAQE-P--------------HLSESRRRFLDGDQLTLADCSLLPKLHIVDTVCAHFRQRPI 196

  Fly   177 DA-----TKYPELAAWIKRIK 192
            .|     .:|.:.|...|..|
  Rat   197 PAELSCVRRYLDSALQEKEFK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 44/216 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/87 (20%)
GST_C_Delta_Epsilon 91..208 CDD:198287 23/113 (20%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 44/216 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.