DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTT2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens


Alignment Length:204 Identity:61/204 - (29%)
Similarity:92/204 - (45%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76
            |.|.|:|.:..:...:..:.:.|:|::.:|...|||:||.|..:|.|.|..|.|.:|.||..||.
Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75

  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW------------------ENK 123
            .||...|..||.||:.||.|.:.|.:.:..:..|   ...|| |                  .|:
Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCIRGT---FGIPL-WVQVLGPLIGVQVPKEKVERNR 136

  Fly   124 TEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPE 183
            |.:.|| :..||      :.||.:..:|||..:|:||...:..|     .|:.:|     ...|.
Human   137 TAMDQA-LQWLE------DKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELF-----EGRPR 189

  Fly   184 LAAWIKRIK 192
            ||||..|::
Human   190 LAAWRGRVE 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 61/204 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/64 (36%)
GST_C_Delta_Epsilon 91..208 CDD:198287 31/125 (25%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 23/66 (35%)
GstA 14..210 CDD:223698 59/201 (29%)