DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic2

DIOPT Version :10

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:173 Identity:41/173 - (23%)
Similarity:69/173 - (39%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76
            :||   .|:..:.|..|| .||...:||....|.:..::|.:            .:|..:...|.
  Rat    69 NPP---FLIYNKELKTDF-IKIEEFLEKTLAPPRYPHLSPKY------------KESFDVGCNLF 117

  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRA---ITFPLFWENKTEIPQARIDALEGVY 138
            :|:    |.|.|:.:|.|    ..:::.|::....|.   :..||       :.:...|:.|...
  Rat   118 AKF----SAYIKNTQKEA----NKNFEKSLLREFKRLDDYLNTPL-------LDEIDPDSTEERT 167

  Fly   139 KSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKY 181
            .|..|||:      ||.||:||..::..|.    .:.|.|.||
  Rat   168 LSRRLFLD------GDQLTLADCSLLPKLN----IIKVAAKKY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..200 CDD:440390 41/173 (24%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 10/30 (33%)
O-ClC 12..245 CDD:129941 41/173 (24%)
G-site. /evidence=ECO:0000250|UniProtKB:O15247 30..33
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.