DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:173 Identity:41/173 - (23%)
Similarity:69/173 - (39%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76
            :||   .|:..:.|..|| .||...:||....|.:..::|.:            .:|..:...|.
  Rat    69 NPP---FLIYNKELKTDF-IKIEEFLEKTLAPPRYPHLSPKY------------KESFDVGCNLF 117

  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRA---ITFPLFWENKTEIPQARIDALEGVY 138
            :|:    |.|.|:.:|.|    ..:::.|::....|.   :..||       :.:...|:.|...
  Rat   118 AKF----SAYIKNTQKEA----NKNFEKSLLREFKRLDDYLNTPL-------LDEIDPDSTEERT 167

  Fly   139 KSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKY 181
            .|..|||:      ||.||:||..::..|.    .:.|.|.||
  Rat   168 LSRRLFLD------GDQLTLADCSLLPKLN----IIKVAAKKY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 41/173 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/64 (22%)
GST_C_Delta_Epsilon 91..208 CDD:198287 23/94 (24%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 10/30 (33%)
GST_N_CLIC 9..99 CDD:239359 11/33 (33%)
O-ClC 12..245 CDD:129941 41/173 (24%)
GST_C_CLIC2 106..244 CDD:198331 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.