DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Eef1g

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:184 Identity:54/184 - (29%)
Similarity:82/184 - (44%) Gaps:19/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEFLKINPLHTVPALD-DNGFYLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHY-DSSV 106
            ||||:..|...|||.: |:||.:.:|:|| :|.||    |:.|.....:..|.|.|.:.: ||.:
  Rat    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAI-AYYVS----NEELRGSTPEAAAQVVQWVSFADSDI 106

  Fly   107 V--TSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLF---LENGNYLAGDNLTIADFHVIAG 166
            |  .||....|..:...||    ||..:|.|.|.:.|.|.   |:...:|.|:.:|:||..|:..
  Rat   107 VPPASTWVFPTLGIMHHNK----QATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCT 167

  Fly   167 LTGFF--VFLPVDATKYPELAAWIKRIKELPYYEEANGS-RAAQIIEFIKSKKF 217
            |...:  |..|.....:|....|.......|.:....|. :..:.:....:|||
  Rat   168 LLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 49/159 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/33 (45%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/125 (26%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 17/39 (44%)
maiA 5..187 CDD:273527 48/148 (32%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 32/125 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 1/1 (100%)
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.