DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and CLIC4

DIOPT Version :10

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:152 Identity:37/152 - (24%)
Similarity:66/152 - (43%) Gaps:38/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHA-INSYLV-SKYGRNDSLYPKDLKKRA 94
            ||...:|:....|::||::|.|  |..:..|.   |..| .::|:. |:...|::|....||...
Human    90 KIEEFLEEVLCPPKYLKLSPKH--PESNTAGM---DIFAKFSAYIKNSRPEANEALERGLLKTLQ 149

  Fly    95 IVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIA 159
            .:|:.|:              .||    ..||.:   :::|.:..|...||:      |:.:|:|
Human   150 KLDEYLN--------------SPL----PDEIDE---NSMEDIKFSTRKFLD------GNEMTLA 187

  Fly   160 DFHVIAGLTGFFVFLPVDATKY 181
            |.:::..|.    .:.|.|.||
Human   188 DCNLLPKLH----IVKVVAKKY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..200 CDD:440390 37/152 (24%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101 3/10 (30%)
O-ClC 17..252 CDD:129941 37/152 (24%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.