DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTT4

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:202 Identity:54/202 - (26%)
Similarity:96/202 - (47%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76
            |.|.|:|.:..:..::.|:::.|:|::..|....::.||||..:|:|.|..|.|::|.||..||.
Human    11 SAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSESAAILYYLC 75

  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFP---LFWENKTEIPQARID------ 132
            .||.......|.|...||.||:.:.:..:       |...|   :.| .|..||:...:      
Human    76 RKYSAPSHWCPPDPHARARVDEFVAWQHT-------AFQLPMKKIVW-LKLLIPKITGEEVSAEK 132

  Fly   133 ---ALEGVYKSLNL----FLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPELA 185
               |:|.|..||.|    ||::..::.|:.:::||...:..:     ..:.|||  :::|   ||
Human   133 MEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADLVAVVEMMQPMAANYNVFL--NSSK---LA 192

  Fly   186 AWIKRIK 192
            .|..:::
Human   193 EWRMQVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 54/202 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/64 (34%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/123 (23%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 22/66 (33%)