DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gst1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:226 Identity:59/226 - (26%)
Similarity:97/226 - (42%) Gaps:43/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDD---NG 62
            |.:.||:.....|....|:..|:.|:|.::.:.||..:.|...||.|.:||...||.|.|   |.
pombe     1 MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNND 65

  Fly    63 FYLADSHAINSYLVSKYG--RNDSLYPKDLKKRAIVDQRLHYDSS---VVTSTGRAITFPLFWEN 122
            :.:.:|.||..||..||.  |..|| |:|..:...|.|.|.:.:|   ::  .|:|..|.::.:.
pombe    66 YTIWESDAILIYLADKYDTERKISL-PRDHPEYYKVIQYLFFQASGQGII--WGQAGWFSVYHQE 127

  Fly   123 ---------KTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFL---- 174
                     :.||.:. :..||.:       |::.:||..:..||||...|: ...|...:    
pombe   128 LVISAITRYRNEIKRV-LGVLEDI-------LKDRDYLVANRFTIADLSFIS-WNNFLEIIFAEG 183

  Fly   175 ---------PVDATK-YPELAAWIKRIKELP 195
                     .:|..| :|...:|.:|:...|
pombe   184 KFSIEEEVPQLDFEKEFPRTYSWHQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 57/221 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/75 (33%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/131 (20%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 27/80 (34%)
GstA 5..218 CDD:223698 58/222 (26%)
GST_C_Ure2p 96..219 CDD:198326 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.