DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gstt1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus


Alignment Length:201 Identity:62/201 - (30%)
Similarity:96/201 - (47%) Gaps:32/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76
            |.|.|::.:..:..|:.|....|.|.:.|||...|.::||:..|||:.|.||.|.:|.||..||.
  Rat    11 SQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCESVAILLYLA 75

  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYD-----SSVVTSTGRAITFPLFWENKTEIPQARIDALEG 136
            .||...|..||:||:.||.||:.|.:.     .|.:.:....:.||:|...     |.|.:.|..
  Rat    76 HKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGE-----QIRPEMLAA 135

  Fly   137 VYKSLNL--------FLENGNYLAGDNLTIAD-------FHVIAGLTGFFVFLPVDATKYPELAA 186
            ....|::        ||::.::|.|.::::||       .|.:.|  |..||     ...|.|||
  Rat   136 TLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGG--GCPVF-----EGRPRLAA 193

  Fly   187 WIKRIK 192
            |.:|::
  Rat   194 WYRRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 62/201 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/64 (39%)
GST_C_Delta_Epsilon 91..208 CDD:198287 30/122 (25%)
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 25/66 (38%)