DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GstE9

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:221 Identity:101/221 - (45%)
Similarity:145/221 - (65%) Gaps:1/221 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            ||||.|||::.|||||:..|||.||.|.::|::|||:..||...||...||.||||.|:|:|.::
  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65

  Fly    66 ADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVV-TSTGRAITFPLFWENKTEIPQA 129
            .:||||.:|||.:|.::|.|||||..|||:||||||::|.|: ....|.|..|||::|.||:|::
  Fly    66 WESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRS 130

  Fly   130 RIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL 194
            :|||:...|..|..|:.|..||.|..:||||:.|::.::.......:||.:||:|..|:.|:...
  Fly   131 QIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDRMAAQ 195

  Fly   195 PYYEEANGSRAAQIIEFIKSKKFTIV 220
            |.|:..||:.|..:|:...||...||
  Fly   196 PNYQSLNGNGAQMLIDMFSSKITKIV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 88/191 (46%)
GST_N_Delta_Epsilon 4..77 CDD:239343 38/72 (53%)
GST_C_Delta_Epsilon 91..208 CDD:198287 47/117 (40%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 90/196 (46%)
GST_N_Delta_Epsilon 4..76 CDD:239343 37/71 (52%)
GST_C_Delta_Epsilon 92..209 CDD:198287 47/116 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467989
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.