DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gdap1l1

DIOPT Version :10

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:72 Identity:19/72 - (26%)
Similarity:33/72 - (45%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |.||....|...:.|.|.:....|..:.:.|:|.:.||.:|.|:::|....||.:......::|.
Mouse    47 LVLYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDY 111

  Fly    69 HAINSYL 75
            ..|..|:
Mouse   112 DQIIDYV 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..200 CDD:440390 19/72 (26%)
Gdap1l1NP_659140.2 GST_N_GDAP1 47..119 CDD:239350 19/72 (26%)
GST_C_family 201..311 CDD:470672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.