Sequence 1: | NP_611325.2 | Gene: | GstE3 / 37108 | FlyBaseID: | FBgn0063497 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006524198.1 | Gene: | Clic5 / 224796 | MGIID: | 1917912 | Length: | 485 | Species: | Mus musculus |
Alignment Length: | 212 | Identity: | 47/212 - (22%) |
---|---|---|---|
Similarity: | 78/212 - (36%) | Gaps: | 61/212 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GIDGS-----PPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
Fly 68 SHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAI--TFPLFWENKTEIPQAR 130
Fly 131 ID-ALEGVYKSLNLFL---------------ENGN---YLAGDNLTIAD------FHVI------ 164
Fly 165 -------AGLTGFFVFL 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE3 | NP_611325.2 | GstA | 4..195 | CDD:223698 | 47/212 (22%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 18/73 (25%) | ||
GST_C_Delta_Epsilon | 91..208 | CDD:198287 | 27/124 (22%) | ||
Clic5 | XP_006524198.1 | O-ClC | 248..483 | CDD:129941 | 47/212 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844834 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |