DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gst-29

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_497118.1 Gene:gst-29 / 190225 WormBaseID:WBGene00001777 Length:209 Species:Caenorhabditis elegans


Alignment Length:176 Identity:51/176 - (28%)
Similarity:75/176 - (42%) Gaps:42/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDS 104
            |.||.:    .|...||.|..:||.:..|.||..||.:|:|.......:.....|||||...:.|
 Worm    42 EKLKDK----TPFGQVPVLYVDGFEIPQSAAIIRYLANKFGYAGKTPEEQAWADAIVDQFKDFMS 102

  Fly   105 SVVTSTGRAITFPLFWE-------NKTEIPQAR------IDALEGVYKSLNLFLE--NGNYLAGD 154
                         ||.|       .|:::..|:      |.|.:..::.:...||  ...:|.||
 Worm   103 -------------LFREFKLAQKAGKSDVEIAKVASEVAIPARDSYFEIITNLLEKSKSGFLVGD 154

  Fly   155 NLTIADFHVIAGLTG-----FFVFLPVDATKYPELAAWIKRIKELP 195
            .||.||..|:..||.     ||     ||:::|:|||..::|..:|
 Worm   155 GLTFADIVVVESLTNLEKVHFF-----DASEHPKLAALREKIYAIP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 50/174 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/36 (39%)
GST_C_Delta_Epsilon 91..208 CDD:198287 35/125 (28%)
gst-29NP_497118.1 GST_N_Sigma_like 4..74 CDD:239337 13/35 (37%)
PTZ00057 6..209 CDD:173353 51/176 (29%)
GST_C_Sigma_like 85..191 CDD:198301 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.