DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gst-14

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:207 Identity:50/207 - (24%)
Similarity:93/207 - (44%) Gaps:27/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PVRSVLLTLRAL----NLDFDYKIVNLMEK--EHLKPEFLKINPLHTVPALDDNGFYLADSHAIN 72
            |||.:..:.|.|    .:.|:.:.||.::.  |.:|.:    .|:..:|.|..:.|.:..|.|||
 Worm    10 PVRGLAESARLLFHLAGVPFEDERVNFLDDTWEKMKGK----TPMGQLPVLTVDDFEIPQSAAIN 70

  Fly    73 SYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSS-----VVTSTGRAITFPLFWENKTEIPQARI- 131
            .||..|:|.......::....|:|||...:.:.     :....|::       ..:.|...|.: 
 Worm    71 RYLARKFGFAGKTPEEEAWVDAVVDQFKDFFAEFRKLVIAKRVGKS-------AEELEKLTAEVI 128

  Fly   132 -DALEGVYKSLNLFLE--NGNYLAGDNLTIADFHVIAGLTGFFVFLPVDAT-KYPELAAWIKRIK 192
             .|::..:|.||..||  ...||.||::|.||.::...:.....:..::|: :.|:|||.::::.
 Worm   129 KPAMDVYFKVLNGLLEKSKSGYLIGDSITFADLYIADNIQTLKKYGLLEASGEQPKLAAHLEKVY 193

  Fly   193 ELPYYEEANGSR 204
            ..|..:....||
 Worm   194 SHPNLKSYIASR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 47/196 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/68 (29%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/124 (23%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 20/68 (29%)
PTZ00057 6..205 CDD:173353 48/205 (23%)
GST_C_Sigma_like 85..192 CDD:198301 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.