Sequence 1: | NP_611325.2 | Gene: | GstE3 / 37108 | FlyBaseID: | FBgn0063497 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509962.1 | Gene: | gst-42 / 183911 | WormBaseID: | WBGene00001790 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 57/206 - (27%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 44/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 VLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLVSKYGRN 82
Fly 83 DSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITF-------PLF------WENKTEI----PQAR 130
Fly 131 IDALEGVYKSLNLFLE--NGNYLAGDNLTIADFHV---IAGLTGFFVFLPVDATKYPELAAWIKR 190
Fly 191 IKELPYYEEAN 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE3 | NP_611325.2 | GstA | 4..195 | CDD:223698 | 55/198 (28%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 21/58 (36%) | ||
GST_C_Delta_Epsilon | 91..208 | CDD:198287 | 32/133 (24%) | ||
gst-42 | NP_509962.1 | GST_N_Zeta | 6..77 | CDD:239340 | 20/57 (35%) |
maiA | 7..211 | CDD:273527 | 57/206 (28%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 32/134 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |