DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and exl-1

DIOPT Version :10

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:39 Identity:12/39 - (30%)
Similarity:16/39 - (41%) Gaps:4/39 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVT 108
            |.|:.|:    |.|....:...|..|.|...|.|..|:|
 Worm   125 AFNTELL----RLDKYLSEQETKFLISDDVTHIDCLVLT 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..200 CDD:440390 12/39 (31%)
exl-1NP_497000.1 GST_C_family 98..210 CDD:470672 12/39 (31%)

Return to query results.
Submit another query.