DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gstz1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:220 Identity:59/220 - (26%)
Similarity:96/220 - (43%) Gaps:34/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEK--EHLKPEFLKINPLHTVPALDDNGFY 64
            ||..||....|.....|.:.|....:|::...:||::.  :....||..:||:..||||..:|..
Mouse     4 GKPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGIT 68

  Fly    65 LADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYD-----------SSVVTSTGRAITFPL 118
            :..|.||..|| .:......|.|:|.:|||||  |:..|           .||:...|:      
Mouse    69 IVQSLAIMEYL-EETRPIPRLLPQDPQKRAIV--RMISDLIASGIQPLQNLSVLKQVGQ------ 124

  Fly   119 FWENKTEIPQARI----DALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDAT 179
              ||:.:..|..|    :|||.:.:|     ..|.|..||.:::||..::..:.....| .||.:
Mouse   125 --ENQMQWAQKVITSGFNALEKILQS-----TAGKYCVGDEVSMADVCLVPQVANAERF-KVDLS 181

  Fly   180 KYPELAAWIKRIKELPYYEEANGSR 204
            .||.::...|.:..|..::.::..|
Mouse   182 PYPTISHINKELLALEVFQVSHPRR 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 55/207 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/74 (30%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/129 (25%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 22/74 (30%)
maiA 7..211 CDD:273527 57/217 (26%)
Glutathione binding 14..19 1/4 (25%)