DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gstt2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:203 Identity:56/203 - (27%)
Similarity:97/203 - (47%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD-------SH 69
            |.|.|:|.:..:...:.|..:.|::::.:|:..:|.::|.|:.||.|.|..|.|.:       |.
Mouse    11 SQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPSSMIPST 75

  Fly    70 AINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITF-----PLFWENKTEIPQA 129
            ||..||.|||...|..||.||:.||.|.:.|.:.:..:..|...:.:     ||.   ..::||.
Mouse    76 AILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLI---GVQVPQE 137

  Fly   130 RI----DALEGVYKSL-NLFLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPEL 184
            ::    |.:..|.:.| :.||.:..:|.|..:|:||...:..|     .|:.:|     ...|:|
Mouse   138 KVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLF-----EGRPQL 197

  Fly   185 AAWIKRIK 192
            .||.:|::
Mouse   198 TAWRERVE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 56/203 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/71 (30%)
GST_C_Delta_Epsilon 91..208 CDD:198287 27/117 (23%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 22/73 (30%)
GST_C_Theta 98..223 CDD:198292 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.