DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gdap1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_034397.1 Gene:Gdap1 / 14545 MGIID:1338002 Length:358 Species:Mus musculus


Alignment Length:306 Identity:57/306 - (18%)
Similarity:91/306 - (29%) Gaps:128/306 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPAL---------- 58
            |.||....|...:.|.|.:....|..:...|:|...||.:|.|:::|....||.|          
Mouse    26 LILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGENIICEA 90

  Fly    59 ---------------------DDNGFY---------LADSHAINSY------------------- 74
                                 |:...|         |.||..:::|                   
Mouse    91 TQIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAY 155

  Fly    75 ----LVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALE 135
                :.|:.|..:|    :|||  :.::......:.:....|..:..|..:|...:.:. :|.||
Mouse   156 ATTRIRSQIGNTES----ELKK--LAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKI-LDELE 213

  Fly   136 GVYKSLNLFL--------ENGN--YLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKR 190
            .|...:...|        |.||  :|.|::.|:||.                     .||..:.|
Mouse   214 KVLDQVETELQRRNEETPEEGNQPWLCGESFTLADV---------------------SLAVTLHR 257

  Fly   191 IKEL----------------PYYEEANGSRAAQIIEFIKSKKFTIV 220
            :|.|                .|||..           :|.|.|..|
Mouse   258 LKFLGFARRNWGHGKRPNLETYYERV-----------LKRKTFNKV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 50/279 (18%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/135 (17%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/142 (18%)
Gdap1NP_034397.1 GST_N_GDAP1 26..98 CDD:239350 17/71 (24%)
GST_C_GDAP1 179..289 CDD:198336 26/142 (18%)
Required for mitochondrial localization. /evidence=ECO:0000250 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.