DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTO2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:197 Identity:46/197 - (23%)
Similarity:77/197 - (39%) Gaps:16/197 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPE-FLKINPLHTVPALDDNGFYL 65
            |.:.:|.:...|......|.|:|  .|..:::||:..:.  ||| :...:|...:|.|:.:...|
Human    22 GLIRIYSMRFCPYSHRTRLVLKA--KDIRHEVVNINLRN--KPEWYYTKHPFGHIPVLETSQCQL 82

  Fly    66 A-DSHAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQ 128
            . :|.....||...| ||  .|:|.|..:||.....|.....|...|...:.........|.:..
Human    83 IYESVIACEYLDDAYPGR--KLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKA 145

  Fly   129 ARIDALEGVYKSLNLFLE--NGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKY-PELAAWIKR 190
                ||...:.:|...||  |..:..|..:::.|:.:........|:..:|...: |.|..||..
Human   146 ----ALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISA 206

  Fly   191 IK 192
            :|
Human   207 MK 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 45/195 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/74 (24%)
GST_C_Delta_Epsilon 91..208 CDD:198287 21/105 (20%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 18/75 (24%)