DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and CLIC1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001274522.1 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens


Alignment Length:176 Identity:41/176 - (23%)
Similarity:59/176 - (33%) Gaps:45/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIVNLMEKEHLKPEFLK---INPLHTVPALDDNGFYLADSHAINSYLVSKYGRNDSLYPKDLKKR 93
            ||...:|.....|.:.|   :||......||....:.|.....|..|      ||:|....||..
Human    79 KIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPAL------NDNLEKGLLKAL 137

  Fly    94 AIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTI 158
            .::|..|              |.||    ..|:.:...:. |||        ....:|.|:.||:
Human   138 KVLDNYL--------------TSPL----PEEVDETSAED-EGV--------SQRKFLDGNELTL 175

  Fly   159 ADFHVIAGLTGFFVFLPVDATKY-----PELAAWIKRIKELPYYEE 199
            ||.:::..|.    .:.|...||     ||....:.|.....|..|
Human   176 ADCNLLPKLH----IVQVVCKKYRGFTIPEAFRGVHRYLSNAYARE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 39/170 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 12/47 (26%)
GST_C_Delta_Epsilon 91..208 CDD:198287 25/114 (22%)
CLIC1NP_001274522.1 Required for insertion into the membrane 2..90 3/10 (30%)
O-ClC 6..241 CDD:129941 41/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.