DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Gsto1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:206 Identity:49/206 - (23%)
Similarity:95/206 - (46%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPE-FLKINPLHTVPALDD-NGFY 64
            |::.:|.:...|..:..|:.|:|..:  .::|:|:..|.  ||| |.:.||...||.|:: .|..
  Rat    22 GQIRVYSMRFCPFAQRTLMVLKAKGI--RHEIININLKN--KPEWFFEKNPFGLVPVLENTQGHL 82

  Fly    65 LADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYD-----SSVVTSTGRAITFPLFWENKT 124
            :.:|.....||...|... .|:|.|..::|.  |::.::     .|:|||..||       :.|.
  Rat    83 ITESVITCEYLDEAYPEK-KLFPDDPYEKAC--QKMTFELFSKVPSLVTSFIRA-------KRKE 137

  Fly   125 EIPQARIDALEGVYKSLN--LFLENGNYLAGDNLTIADFHV---IAGLTGFFVFLPVDATKYPEL 184
            :.|..: :.|:..:..|.  :..:...:..|::|::.|:.:   ...|....:...:|.|  |:|
  Rat   138 DHPGIK-EELKKEFSKLEEAMAKKRTAFFGGNSLSMIDYLIWPWFQRLEALELNECIDHT--PKL 199

  Fly   185 AAWIKRIKELP 195
            ..|:..::|.|
  Rat   200 KLWMATMQEDP 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 47/202 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/74 (28%)
GST_C_Delta_Epsilon 91..208 CDD:198287 23/115 (20%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 21/75 (28%)
GstA 26..214 CDD:223698 48/202 (24%)