DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and LOC100333907

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_009303556.1 Gene:LOC100333907 / 100333907 -ID:- Length:249 Species:Danio rerio


Alignment Length:246 Identity:57/246 - (23%)
Similarity:89/246 - (36%) Gaps:77/246 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GIDGS-----PPVRSVLLTLRALNLDFDYKIVNLMEK----EHLKPEFLKINPLHTVPALDDNGF 63
            |.||.     |..:.:.:.|....:.|:...|:|..|    :.|.|   ..||    |.:..||.
Zfish    23 GSDGESLGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQDLAP---GTNP----PFMTFNGE 80

  Fly    64 YLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQ 128
            .|.|.:.|..:|..:.|  ...|||...|        |.:|:..       ...:|.:....|..
Zfish    81 VLVDVNKIEEFLEERLG--PPQYPKLATK--------HPESNTA-------GIDVFAKFSAYIKN 128

  Fly   129 ARIDALEGVYKSLNLFLE-------------------------NGNYLAGDNLTIADFHVIAGLT 168
            .|.:|.||:.|:|...|:                         ..::|.||.||:||.:::..|.
Zfish   129 PRKEANEGLEKALLKSLKRLDEYLQTPLPEEIDADSLEDPGASTRSFLDGDELTLADCNLLPKLH 193

  Fly   169 GFFVFLPVDATKYPELAAWIKRIKELPYYEEANG-----SRAAQIIEFIKS 214
                .:.:.|.||..|        |:|  .|.:|     ::|.|..|||.:
Zfish   194 ----IIKIVARKYRGL--------EIP--AEMSGIWRYLNKAYQREEFINT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 49/220 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/77 (26%)
GST_C_Delta_Epsilon 91..208 CDD:198287 29/146 (20%)
LOC100333907XP_009303556.1 O-ClC 14..249 CDD:129941 57/246 (23%)
GST_N_CLIC 14..101 CDD:239359 21/86 (24%)
GST_C_family 108..248 CDD:295467 32/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.