DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and CAM1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:48/191 - (25%)
Similarity:83/191 - (43%) Gaps:19/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELY 87
            ::||.||.:....|..|....:|..|||.|....|    .|..:.::.||..||| |.:..|::.
Yeast    21 VKALKLDVKVVTPDAAAEQFARDFPLKKVPAFVGP----KGYKLTEAMAINYYLV-KLSQDDKMK 80

  Fly    88 PR------DLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHL---- 142
            .:      ||..:||:.:......|.|.:.:.|..:|  |:..:...|:.||:..||...:    
Yeast    81 TQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVP--LKGGAPYNKKSVDSAMDAVDKIVDIF 143

  Fly   143 ENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDE--LKYPKVAAWFERLSKLPHYEED 201
            ||.|.:..||....:::|||...:..:.....|...|  .::|.:..||..:...|..:::
Yeast   144 ENRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKDE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 47/184 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/54 (31%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/114 (23%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 18/56 (32%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 26/115 (23%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.