DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and YGR201C

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:56/203 - (27%)
Similarity:78/203 - (38%) Gaps:45/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLV----DKYANS 83
            :|:|.||.:..:.......:.::..|:|.|....|  .|...|. ::.||..||:    ||.|..
Yeast    25 VRSLKLDVKLADPSDAQQLYEREFPLRKYPTFVGP--HDEWTLT-EAMAIDYYLIHLSSDKEAVR 86

  Fly    84 DELYPR-DLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLV-----------------PKE 130
            ..|.|. |...||.:         :.:.||.|..   ||.:|..|                 .:|
Yeast    87 QLLGPEGDFKTRADI---------LRWESLSNSD---FLNEVCEVFFPLIGVKPYNATEFKAARE 139

  Fly   131 KVDNIKDAYGHLENFLGDNPYLT-GSQLTIADLCCGATASSLAAVLDLDEL---KYPKVAAWFER 191
            .||.|...|   |..|....||. ....|:||| ..|.|.||..:...||.   |:|:|..||.|
Yeast   140 NVDTIVSLY---EKRLKKQQYLVCDDHETLADL-ISAAAFSLGFISFFDETWRSKHPEVTRWFNR 200

  Fly   192 LSKLPHYE 199
            :.|...:|
Yeast   201 VIKSRFFE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 55/198 (28%)
GST_N_Delta_Epsilon 5..78 CDD:239343 14/58 (24%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/127 (28%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 14/55 (25%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.