DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GTT2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:52/231 - (22%)
Similarity:97/231 - (41%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNL--DYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLE-DN 62
            |..|:::|.....|.....::.|...|:  ..::..::|..|:|.|..||.||...|||:|| |:
Yeast    15 MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDD 79

  Fly    63 GALIWDSHAIVCYLVDKYANSDELYPRD-------LVLRAQVDQRLFFDASILFMSLRNVSIPYF 120
            |.||.:..||..| :|....:..|..:.       .::..:.:..|....|:.|    :.:.|..
Yeast    80 GTLIAECTAITEY-IDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYF----HHATPGL 139

  Fly   121 LRQVSLVPKE-----KVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDEL 180
            ..:|.|...:     :.|.......:.:..|.:.||:.|...::||:...|.....|.|    :|
Yeast   140 GPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIV----KL 200

  Fly   181 KYPK----VAAWFERLSKLPHYEEDNLRGLKKYINL 212
            :.|:    :.||::|:.:.|        .:||.:.:
Yeast   201 QVPEECEALRAWYKRMQQRP--------SVKKLLEI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 47/209 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/75 (32%)
GST_C_Delta_Epsilon 94..209 CDD:198287 23/123 (19%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 24/75 (32%)
GST_C_GTT2_like 106..222 CDD:198291 22/131 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345146
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.